1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
prisoha [69]
4 years ago
11

Julia needs to make a box in the shape of a rectangular prism with a height of 3 inches and a volume of 243 cubic inches. The di

mensions, in inches, must be whole numbers greater than 1. Julia claims that the length and the width must be equal. Part A: What dimensions would support Julia's claim about the length and with of the box? Part B: What dimensions would not support Julia's claim about the length and width of the box. Part A length =______________ Part A width=_____________________. Part B length_________________Part B Width=_____________________.
Mathematics
2 answers:
umka2103 [35]4 years ago
7 0
The volume of a rectangular prism is equal to length*width*height. In this case, we have V = 243 and H = 3.
243 = LW(3), so LW = 81, where L & W are whole numbers greater than 1. There are only 3 possible pairs of values for this: 27*3, 9*9, and 3*27 (we cannot use 1*81 or 81*1, since we need dimensions > 1).
Part A. This could be true if Length = 9 in and Width = 9 in, as 9*9 = 81.
Part B. The claim could be false if Length = 27 in and Width = 3 in, as 27*3 = 81, but 27 is not equal to 3.
*Note that the width cannot be longer than the length.
natulia [17]4 years ago
6 0
Part A.
 sqrt 81 = 9; L = 9 ; W = 9 inches

Part B.
if length =27 , width =3, though 27*3 = 81 but then 27 is not equal 3. So false
You might be interested in
What’s the function of f(x)=-2/3x -7 ?
Blababa [14]

Answer:

F(x) = -1/3 x^2 - 7x + C

3 0
3 years ago
Complete the equation.<br> 5x + 5x = 10x
eimsori [14]

Answer:

10x2

Step-by-step explanation:

jfdcwfghngkkgfffddnmkhcfhgfegvchnujffghjj

4 0
3 years ago
Read 2 more answers
Which shows one way the equation can be represented in words?
Anuta_ua [19.1K]

Answer:

C

Step-by-step explanation:

8 0
3 years ago
Is 5/6 and 9/10 equivalent?
givi [52]

Answer:

No, they are not equivalent.

Step-by-step explanation:

5 0
3 years ago
Read 2 more answers
Which statements apply to the ratio of rice and water? Choose two options.
NISA [10]
The amount of rice is the independent value.

The amount of water is the dependent value.
8 0
4 years ago
Other questions:
  • Solve the system of equations by substitution. What is the solution for x?. . 2x + y = 1 . 4x + 2y = −2
    14·2 answers
  • Solve the system using the elimination method 3x - y=-12<br> X + y =4
    5·1 answer
  • What is the explicit formula for the sequence?<br><br> 7, 2, –3, –8, –13, . . .
    12·1 answer
  • What is the answer for 9867x5388 i need help
    13·2 answers
  • Need help on this please this one is hard for me
    12·1 answer
  • Find the solution set of 5x+7&gt; 17.
    10·2 answers
  • Omgggg helppp I need this now plss
    8·1 answer
  • Please help. <br>Write a situation that can be represented with this graph. ​
    12·1 answer
  • 1. Find these products.
    9·1 answer
  • Answer please! ))))))))))))))
    15·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!