1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
choli [55]
3 years ago
6

What are the functions of human organs of speech?

Biology
2 answers:
Tresset [83]3 years ago
8 0
The functions of human organs of speech<span> are to produce sounds that are perceived as </span>speech<span> by pushing the air from the lungs up and, while modifying it by various means, out of the mouth. </span>Organs of speech<span> produce consonants and vowels and voiced and voiceless sounds</span>
Anna35 [415]3 years ago
5 0
The functions of the human organs of speech are to produce sounds by exhaling air from the lungs. The air gets obstructed in various ways and you produce various sounds, which then becomes speech.
You might be interested in
All of the page please !!!
bazaltina [42]

Answer:

(a) Allow movement in only one plane/direction (that is extension or flexion)

(b) The skeletal system also produces blood cells in their bone marrow

6 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Why might scientists care about fossils and dating fossils to begin with ?
Lynna [10]
Scientists use fossils to learn about organisms' lives and evolutionary relationships, to understand geological change, and even to locate fossil fuel reserves.
7 0
2 years ago
Will osmosis occur?<br>if so which direction?​
tatyana61 [14]

The solution in the berzelius glass has a concentration of 50%, the other solution has a concentration of 30%. In osmosis water moves from the solution with a lower concentration to the solution with the higher concentration. Therefore, water will move from the 5%glucose,25%starch solution to the 20%glucose, 20%K⁺,10% iodine.

8 0
3 years ago
Read 2 more answers
What is the difference between cellular respiration and the combustion of fossil fuels?
madreJ [45]

Carbon is released into the atmosphere only during the burning of fossil fuels

Explanation:

During the process of fuel burning, carbon is released in the atmosphere. The human invented power plants, factories, cars and other vehicles releases carbon in the form of carbon di-oxide in atmosphere.  

However, the cellular respiration is similar to that of fuel burning as it is too a combustion process. But the carbon produced in this process fuels the inner cellular activities rather than releasing it in the atmosphere.

7 0
3 years ago
Read 2 more answers
Other questions:
  • Suppose that life exists elsewhere in the universe. all life must contain some type of genetic information, but alien genomes mi
    7·1 answer
  • Defending the body against bacterial infection and invasion by foreign substances is a function of __________.
    11·1 answer
  • explain why it is possible to see the detailed structure of a prokaryotic cell with an electron microscope but not with a light
    13·1 answer
  • Arrange these elements of the intrinsic conduction system in the order that a depolarizing impulse travels during a normal heart
    15·1 answer
  • How is sexual reproduction different from asexual reproduction??
    5·1 answer
  • In an individual that is heterozygous for a particular trait, expression of the recessive allele is masked. In an individual tha
    13·1 answer
  • What are the branching, threadlike tubes that make up the bodies of multicellular fungi
    13·2 answers
  • A student builds a model of a DNA strand.
    9·2 answers
  • Can anyone help me in this question!!!
    15·1 answer
  • can someone help me with this immediately!!!! pls don’t guess or leave links!! correct answer gets brainiest
    13·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!