Answer:
Oceanic crust is denser than continental crust. At a subduction zone, the oceanic crust usually sinks into the mantle beneath lighter continental crust. (Sometimes, oceanic crust may grow so old and that dense that it collapses and spontaneously forms a subduction zone, scientists think.)
Explanation:
Answer:
1.Plasma membrane
The plasma membrane surrounds the cell to create a barrier between the cytosol and the extracellular matrix. Plasma membranes also enclose lumens of some cellular organelles.
2.Endoplasmic reticulum
The endoplasmic reticulum (ER) is a large network of membranes responsible for the production of proteins, metabolism and transportation of lipids, and detoxification of poisons. There are two types of endoplasmic reticulum with separate functions: smooth endoplasmic reticulum and rough endoplasmic reticulum. The presence or absence of ribosomes in the ER’s plasma membrane determines whether it is classified as smooth or rough ER.
3.Golgi apparatus
The Golgi apparatus appears as a series of flattened, membranous sacs, or cisternae, that resemble a stack of pancakes just off the rough endoplasmic reticulum. It receives vesicles containing proteins recently produced by the rER. The Golgi apparatus can be compared to a warehouse or post office for newly formed proteins. Here the proteins are further modified, packaged, and sent off to their final destinations in the cell or body.
Answer:
The oxygen enters the bloodstream from the alveoli, tiny sacs in the lungs where gas exchange takes place (Figure below). The transfer of oxygen into the blood is through simple diffusion. ... While oxygen moves from the capillaries and into body cells, carbon dioxide moves from the cells into the capillaries.
Explanation:
<h3>
Answer:</h3><h3>Hydrocarbons are the organic compounds that only contain hydrogen and oxygen element.</h3>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
