1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
iragen [17]
3 years ago
7

Which equation represents "the sum of eight times a number and seven is twice the number"? A) 8(7 + 2N) B) 8N = 7 + 2N. C) 7N +

8 = 2N. D) 8N + 7 = 2N
Mathematics
2 answers:
Yuliya22 [10]3 years ago
7 0
The sum of 8 times a number and 7.....sum means add
8n + 7

is twice the number...is means equals
= 2n

so we have : 8n + 7 = 2n
igor_vitrenko [27]3 years ago
7 0
Out of the following choices given, the equation that represents "the sum of eight times a number and seven is twice the number" is 8N+7=2N. The correct answer will be D. 
You might be interested in
Square Root of 100 minus square root of 9
Alex17521 [72]

Answer:

7

Step-by-step explanation:

3 0
3 years ago
Read 2 more answers
What is the value of X<br><br> 1/2(9-2x)=X+1
Sladkaya [172]
First distribute 1/2 into (9-2x) which would give you:
4.5-1x= x+1
then you add 1x to each side and you will get:
4.5=2x+1
then you subtract 1 from each side and you will get:
3.5=2x
finally divide 3.5 by 2 and you will get:
x = 1.75

Hope this helps
4 0
3 years ago
3. Roger runs 8 miles per hour. He ran for h
kumpel [21]

Answer:

8<em>h</em>

Step-by-step explanation:

8 miles per hour

<em>h</em> hours

plug in <em>h </em>for how many hours

8 divided by 6 is 1.3

1.3 hours to run 6 miles

8 0
2 years ago
Find the area of each shade region <br> (can you do both for me please)
grandymaker [24]
*FORMULA*

Qu1.

area \: of \: a \: triangle = \frac{1}{2} base \: \times height

Height=10

Base=8

= \frac{1}{2} \times 8 \times 10

= 40

Qu2.
Area of a kite=half×product of digonals
Step by step solution
Summation of 1st diagonal =5+5
=10
Summation of 2nd diagonal =7+5
=12
Product of the diagonals
=10×12
=120
Area=1÷2×120
=60
3 0
3 years ago
Read 2 more answers
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
Other questions:
  • Courtney reads about 110 words per minute she procrastinated and now has less then a week to finish her reading assignment if th
    7·1 answer
  • Who else has to do IXL it sucks
    8·1 answer
  • Помогите с МАТЕМАТИКОЙ пожалуйста!
    10·1 answer
  • At 8:00 AM a bicyclist departed city A, heading towards city B at a rate of 20 km/h. After traveling for 4 hours he stopped for
    10·1 answer
  • I need help solving question 56, 58 and 59.
    12·1 answer
  • Nhich equation represents a line that passes through (-9, -3) and has a slope of -6?
    13·1 answer
  • Which is a common denominator of 1 /4 and 3/ 5<br> Please help
    6·2 answers
  • 5) 5n2 + 10n + 20<br><br>how do you solve this? ​
    13·2 answers
  • Can you click on this link and donate? https://www.patreon.com/rising_up77
    15·1 answer
  • Find the 66th term of the arithmetic sequence -28,-45, -62,-
    15·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!