1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
balandron [24]
3 years ago
6

When constructing the dna molecule what did you notice about the the orientation if the two strnads

Biology
1 answer:
MrRissso [65]3 years ago
8 0

Answer:

<em>One of the strands is inverted. Both the strands are anti-parallel to each other.</em>

Explanation:

Deoxyribonucleic acid (DNA) is a double helix structure made up of two strands. Both the strands remain intact due to the hydrogen bonding present in them.

Both the strands are anti-parallel to each other. One strand runs in the 5'-3' direction and is known as the leading strand. The other strand runs in 3'-5' direction and is known as the lagging strand. Hence, both the strands have an opposite orientation.

You might be interested in
James is making models of plant and animal cells using objects supplied by his teacher to represent organelles. For one cell, he
Ber [7]
Since the cell is in a shoebox, we can assume this cell is a plant cell. the balloon most likely represents the vacuole, which is the largest organelle in the plant cell. the marbles could represent ribosomes, but ribosomes aren’t the only round organelle so i’m not sure about that one.
5 0
4 years ago
Read 2 more answers
If a volcano were to erupt and release large amounts of ash into the air, how would this affect the climate on Earth? A. The ash
nataly862011 [7]

Answer:

A. The ash would increase the albedo and decrease the global temperature

Explanation:

The volcanoes can have a big impact on the global temperature. If the volcanic eruption is big enough, and the volcanoes manages to propel very large amount of ash in the atmosphere, the whole planet will feel the effect. The ash will make a layer in the atmosphere around the planet. This layer will increase the albedo of the atmosphere, as the ash will block big portion of the sunlight. That will result in much less sunlight reaching the surface of the Earth, thus in sharp decrease in the global temperatures.

3 0
3 years ago
huntington disease is a dominant disease caused by expansion of the trinucleotide repeat region of the htt gene that results in
Travka [436]

By haphazardly introducing a transgene harboring a disease-causing mutant variant of the HTT gene into the genome of a mouse or primate, it is possible to produce an animal model with the majority of the symptoms of this condition. Here option B is the correct answer.

Huntington's disease is an uncommon, genetic condition that results in the gradual degeneration of brain nerve cells. Huntington's illness, which frequently results in mobility, cognitive, and psychological problems, has a substantial impact on a person's functional capacities.

A DNA region known as a CAG trinucleotide repeat is involved in the HTT mutation that causes Huntington's disease. Three DNA-building building pieces that are repeated several times in a row make up this region.

Complete question:

Huntington's disease is a dominant disease caused by the expansion of the trinucleotide repeat region of the Htt gene that results in the production of a Huntingtin protein with an expanded number of glutamines. An animal model with most features of this syndrome could be created by

A - knocking in a wild-type copy of the Htt gene to a mouse or primate genome.

B - randomly inserting a transgene containing a wild-type allele of the Htt gene to a mouse or primate genome.

C - randomly inserting a transgene containing a disease-causing mutant allele of the Htt gene into a mouse or primate genome

D - knocking out one copy of the wild-type Htt gene from a mouse or primate genome.

E - knocking out both copies of the wild-type Htt gene from a mouse or primate genome.

To learn more about Huntington's disease

brainly.com/question/12572808

#SPJ4

3 0
1 year ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
what is the force needed to move a boy and his wheelchair with a combined mass of 30kg at 0.4 meters per square second
vichka [17]

Answer:

The force needed to move a boy and his wheelchair with a combined mass of 30kg at 0.4 meters per square second is 12 newton.

Explanation:

  • According to Newton's second law based motion "the moving object's acceleration is based upon two terms - one is the total force acting upon that object and the other one is the net mass of the object."
  • In mathematical term, F=ma. where F= force, m= mass, a= acceleration.
  • So, by performing the calculation, \bold{\mathrm{F}=30 \times 0.4 \mathrm{N}=12 \mathrm{N}}
  • 12N force will move the boy along with the wheel chair.
8 0
3 years ago
Other questions:
  • The pee has protein?
    14·2 answers
  • Where does a nurse expect to hear bronchovesicular lung sounds in a healthy adult?
    10·1 answer
  • The long term weather conditions in an an area is re
    11·1 answer
  • Which of the following is not a group of organic compounds?
    14·1 answer
  • Proteins that are involved in packaging the eukaryotic chromosome into "beads" called __________ are __________.
    6·1 answer
  • Which of the following describes a phenomenon that occurs when we observe plants that wilt?
    6·2 answers
  • The conversion of nitrogen gas to compounds useful to crops is called
    5·1 answer
  • Which statement BEST describes why mycelium, constructed of hyphae, are necessary for fungi survival?
    9·1 answer
  • How do the respiratory and excretory systems work together to help people grow and survive
    8·1 answer
  • The most common usable form of energy in a cell is
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!