The infectious diseases are considered as emerging when their occurrences have increased in the past few years and could increase in the coming time like SARS, H1N1, or HIV/Aids.
On the other hand, the re-emerging infectious disorders are those, which were once considered as the major health issues globally or in a specific nation, and then got diminished drastically, however, are again turning into the health issues for a substantial ratio of the population like tuberculosis and malaria.
Answer:
drinking water after a long run
Explanation:
When there arises a change or shift in the state or action of any organism because of any external stimulus, the result is said to be the response to external stimulus. The response or reaction to the external stimulus arises when the organism experiences or senses the stimulus.
Drinking water after a long run is an example of the response to external stimulus. Here, the external stimulus is the loss of water in the water because of the action of running. This makes the individual drink water which is a response to the external stimulus.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Prokaryotic cells divide using fusion and eukaryotic reproduce by mitosis.
