Enzymes are sometimes called biological catalysts
Organ system is the answer according to me if it is one word question
ALS is a rapidly progressive and fatal neuromuscular disease. MS is a scarring and hardening of the sheath around the nerves in the brain, spinal cord, and optic nerve. MD is a muscular disorder with specific kinds of MD involving different muscles in the body. MD is almost exclusively hereditary
<h3>What is Amyotrophic lateral sclerosis (als) ?</h3>
The motor neurons steadily degrade and eventually die as a result of ALS. The brain, spinal cord, and all the muscles in the body are connected by motor neurons. When motor neurons are destroyed, they stop communicating with the muscles, which prevents the muscles from working.
- Five to ten percent of all ALS cases are familial, meaning the patient gets the illness from a parent. Typically, only one parent needs to have the disease-causing gene to have familial ALS.
Learn more about Amyotrophic lateral sclerosis here:
brainly.com/question/14863487
#SPJ4
The answer is D its tightly packed cells allow for proctection against harmful substances.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.