Answer:
Likewise, competition for food among deep-water fish that eat the same types of food will .
Explanation:
Natural selection will condemn all deep-sea fish to the same environment that conditions them, those that cannot develop gills will be exposed to extinction, this refers to the theory of the evolution of the fittest by Charles Darwin.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The independent variable is the temperature. Independent variable refers to the variable in an experiment that can be changed by the scientists or the one making the experiment. A good experiments has a single independent variable and the changes observed will be the dependent variable. In this case, the dependent variable is the gender of the turtle.
Answer:
O: Type O individuals can donate blood to anyone, because their blood has no antigens. However, they can only receive blood from other type O individuals (because blood with any antigens is seen as foreign).
Answer:
cellular respiration
Explanation:
Cellular respiration, the process by which organisms combine oxygen with foodstuff molecules, diverting the chemical energy in these substances into life-sustaining activities and discarding, as waste products, carbon dioxide and water.
