Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
They are capable of regenerating body parts
.
Explanation:
Ambystoma mexicanum or commonly "axolotl" is an amphibian that live in the Mexican basin and currently is in danger due to the destruction of its natural habitat. This species is used in scientific research because the axolotl is capable of regenerating lost parts of their bodies.
Serch it up might have some answers on there:)
Target Tissues or organs <span />
Answer:
The bacterium Vibrio cholerae is the primary cause of cholera disease that mainly infects the small intestine and primarily leads to the dehydration of the body.
Explanation:
The genetic analysis reveals that the aforementioned causative bacteria surpass the acidic conditions of the stomach and eventually reaches the intestinal wall and attaches to it. This is followed by the production of toxic protein by the bacterium. This protein is taken inside the cell via receptor mediated endocytosis followed by its binding to the host protein Arf6. This binding leads to the production of cAMP that results in the dehydration process. This mechanism leads to excessive accumulation of chloride ion in the intestine preventing the entry of sodium ion.
These two ions are associated with the creation of water-salt environment in the intestine that leads to tremendous diarrhea via the process of osmosis.
Hence, we can say that cholera bacterium affects the individuals at the cellular level and osmosis plays a vital role in the process.
