1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Kruka [31]
3 years ago
10

What is a hypothesis

Biology
2 answers:
Contact [7]3 years ago
7 0

A hypothesis is basically a prediction of what you think is going to happen during a science experiment.


A good hypothesis should have an "If... Then... Because..." format.

Ex: If we put a bowl of ice cream and an icecube outside, then the icecube will melt first because there is more icecream than icecubes.

pochemuha3 years ago
7 0

A hypothesis is an "educated guess", and is usually solved by an experiment to see if it is true or false.

hope this helps

You might be interested in
Which of the following is not a mechanism of microevolution?
ikadub [295]
Speciation is not a mechanism of microevolution.
8 0
3 years ago
Read 2 more answers
In the above diagram of a plant cell, what is the function of structure 3?
kramer

Explanation:

B.  serves as the control center of the cell and contains the cell's genetic information

All the genetic information within the eukaryotic cell is stored within the nucleus as helical DNA. This DNA is tightly wounucleuscarbohynd around histones as chromosomes. Chromosomes within the nucleus is unwound, unzipped and read by enzymes in a complex series of steps known as transcription. The message on DNA, called genes is copied by RNA polymerase, to form mRNA complementary sequence to that of the DNA strand. These are then translated into proteins in ribosomes.

Further Explanation:

A cell's structural components (i.e. their makeup) determine their function (what they do) . For instance, photosynthesizing cells in algae and plants have structures called chloroplasts. These contain chlorophyll, a specialized compound which facilitates the conversion of light energy to energy stored in carbohydrates. In specific cell types, collected proteins may function as a unit called an organelle. Some organelles are bound by membranes like those that make up the external structure of the cell, with varying compositions of phospholipids and proteins. These are advantageous, as they:

  • may increase metabolic reaction efficiency; they allow cells to concentrates smaller fractions of enzymes and solutes
  • separate proteins and molecules that me harm the cell by parceling them into membrane-bound organelles for example, proteaseas bound within lysosomes can break down many structural proteins

Learn more about cellular life at brainly.com/question/11259903

#LearnWithBrainly

6 0
3 years ago
How would you explain Marine Biology to a 5 year old?
Licemer1 [7]
The biology in which we study about the life of marine and what they eat and how they eat..ig thats how i will explain idk
5 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
The structure labeled as x is the ____ so the cell in the image is a ____ the structure labeled as w is the ______ so the cell i
il63 [147K]
Mass. Protocol . Hydrated. Particle
7 0
3 years ago
Other questions:
  • Why do our classification systems change?
    14·1 answer
  • Which two characteristics are used to classify stars on the hertzsprung-russell diagram?
    8·2 answers
  • I digest waste and recycle old cell parts.What type of cell organelle am I?
    8·1 answer
  • What can be used to measure the rate of photosynthesis
    9·1 answer
  • How does a newborn animal know exactly what to do the moment its born
    11·1 answer
  • Which of the following is an abiotic factor that is having a negative impact on marine populations
    7·1 answer
  • You and other scientists have been able to get the same results after many experiments. What is this proven data called?
    8·1 answer
  • Starchy grain is dominant over sugary corn. If, in a cross between these types, 58 of the progeny are sugary, how many of the pr
    14·1 answer
  • _________is/are an essential part of our nerves, spinal cord, brain, and cell membranes.
    13·1 answer
  • All enzymes are examples of which type of organic molecule?.
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!