Speciation is not a mechanism of microevolution.
Explanation:
B. serves as the control center of the cell and contains the cell's genetic information
All the genetic information within the eukaryotic cell is stored within the nucleus as helical DNA. This DNA is tightly wounucleuscarbohynd around histones as chromosomes. Chromosomes within the nucleus is unwound, unzipped and read by enzymes in a complex series of steps known as transcription. The message on DNA, called genes is copied by RNA polymerase, to form mRNA complementary sequence to that of the DNA strand. These are then translated into proteins in ribosomes.
Further Explanation:
A cell's structural components (i.e. their makeup) determine their function (what they do) . For instance, photosynthesizing cells in algae and plants have structures called chloroplasts. These contain chlorophyll, a specialized compound which facilitates the conversion of light energy to energy stored in carbohydrates. In specific cell types, collected proteins may function as a unit called an organelle. Some organelles are bound by membranes like those that make up the external structure of the cell, with varying compositions of phospholipids and proteins. These are advantageous, as they:
- may increase metabolic reaction efficiency; they allow cells to concentrates smaller fractions of enzymes and solutes
- separate proteins and molecules that me harm the cell by parceling them into membrane-bound organelles for example, proteaseas bound within lysosomes can break down many structural proteins
Learn more about cellular life at brainly.com/question/11259903
#LearnWithBrainly
The biology in which we study about the life of marine and what they eat and how they eat..ig thats how i will explain idk
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.