1. The virus attaches itself to a host cell
2. The virus inserts its nucleic acid into the host cell
3. The virus nucleic takes over the host cell and makes virus parts
4. The cell creates more viruses
5. The cell bursts, releasing the new viruses
Answer:
sbuhsushsbjsubyshshsushajjwb
sughsnjsjsjnsjsjshwhwjushsjsjnjsin
shuwihijwijsijsjisijsijsjsjenksinisjsni
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
How could energy have played a role in the different rock types forming? Energy causes different types of rock to change in different ways. Energy changes igneous rock into liquid rock and changes sedimentary rock into small pieces of rock. ... No, sedimentary rock can only form out of material from other sedimentary rock.D
Explanation:
The answer is Photosynthesis
