1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Leni [432]
3 years ago
15

Why did slavery spread in the south

History
2 answers:
murzikaleks [220]3 years ago
6 0
When inventions like the cotton gin were invented, more slaves were needed to pick cotton.
drek231 [11]3 years ago
3 0
The south had better farmland than the north, which means more cotton, tobacco, and sugar cane so the slaves had more work down in the south than they did in the north, The cotton gin was also a new invention so the cotton was in high demand which was more work from the slaves.
You might be interested in
What was the main purpose for separation of powers?
Lena [83]

Answer:

The intent of separation of powers is to prevent the concentration of unchecked power by providing for "checks" and "balances" to avoid autocracy, over-reaching by one branch over another, and the attending efficiency of governing by one actor without need for negotiation and compromise with any other.

Explanation:

....

4 0
3 years ago
Read 2 more answers
Why were colonists in new england angry at king james ii and governor edmund andros of new england?
Naily [24]
They allowed the Church of England to exist in New England.
8 0
3 years ago
Read 2 more answers
Will give Brainliest
motikmotik
From what I remember, I think it was because he didn't equip his troops well

Hope its right. 

Hope I helped too.
7 0
3 years ago
Read 2 more answers
Look back at the paragraph you wrote for Activity 14. Now that you have finished reading the novel, add another paragraph that s
Vedmedyk [2.9K]
Ooiiuuytrrrwwassssssdddfffffffggggghhhhhhkkkllllmmnnbbvvcccz
5 0
3 years ago
Which hominid built shelters of wood and skin?
sattari [20]

Answer: Homo Erectus

Explanation:

Homo Erectus developed into Homo Sapiens.

3 0
3 years ago
Other questions:
  • · Bay of Pigs
    7·2 answers
  • In a minimum 200 words, compare the positions of a conservative and a liberal in the nineteenth century on the nature of politic
    6·1 answer
  • Which of the following is true regarding a restrictive adjectival clause?
    15·2 answers
  • Which option explains why the knight will be the first to tell his tale? The innkeeper insists that he begin first. He arrived a
    15·1 answer
  • Voting assemblies were made up of ______ who voted on behalf on a group of citizens.
    14·1 answer
  • What is a thread-like structure made of dna and protein?
    5·1 answer
  • During the early 1980s, conservatives objected to what they believed were excesses in
    13·1 answer
  • How old were the youngest volunteers and draftees in World War II?
    11·1 answer
  • State governments are given rights that the federal government does not have. Three of these are issues handled by the states.
    10·2 answers
  • You have to hold yourself accountable for your actions, and thats how we are going to protect the Earth. Keeping the above state
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!