1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
stealth61 [152]
3 years ago
8

Question 1 (1 point)

Mathematics
1 answer:
katrin [286]3 years ago
7 0

Answer: 400

Step-by-step explanation:

25÷4=6.25

2500÷6.25=400

You might be interested in
You roll a die 100 times interested in finding the number of rules that come up even. Which of the following reasons is needed t
Digiron [165]

<u>Answer: </u>

Option(D) -each roll of the die has two equally likely outcomes

<u>Explanation: </u>

In probability theory, the binomial statistical distribution refers to a distinct distribution of no. of desired effects in sequential autonomous experiments, where each experiment ask a question for ‘yes’/’no’, and each with its own probable boolean-assessed outcome.

A binomial experiment must satisfy the following 4 conditions: (a) Number of trials should be fixed; (b) Every trial should be independent of another; (c) Only two outcomes are there; (d) the chance of each result from trial to trail remains

7 0
3 years ago
Read 2 more answers
I need y’alls help !!
iren2701 [21]

Answer for this prob

8 0
3 years ago
A direct variation function contains the points (–8, –6) and (12, 9). Which equation represents the function?
pav-90 [236]
Y = kx

(-8, -6)

k = 3/4
5 0
4 years ago
Read 2 more answers
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
-0.9+28<br> ----<br> 6<br> help me solve the task <br>im a little lazy ​
Anvisha [2.4K]

Answer:

around 4.52.

Fraction form: 4\frac{52}{100}

Step-by-step explanation:

Brainliest?

7 0
3 years ago
Other questions:
  • Fiona wrote the linear equation y = x – 5. When Henry wrote his equation, they discovered that his equation had all the same sol
    9·2 answers
  • A circle circumference is approximately 76 cm. estimate the radius diameter and area of the circle
    8·1 answer
  • Which lists all the integer solutions of the equation |x| &lt;3
    11·1 answer
  • Please can someone give me a answer of number 1 and 2 and explain by showing how to do it. Thank you
    8·1 answer
  • Tia, from the blog "Talk to Tia," asked her readers, "If you had to do it over again, would you take more college prep courses i
    7·2 answers
  • Write 1/6 as a recurring decimal with working out
    7·2 answers
  • A cone of volume 54π is cut by a plane parallel to the base, 1/3 of the way up the height of the cone (from the base). Find the
    11·1 answer
  • Which describes the difference between the two sequences? First Sequence: 1, 6, 36, 216 ... Second Sequence: 3, 6, 9, 12, ... Th
    13·1 answer
  • Arie's airplanes tracked the number of television advertisements they ran along with the corresponding airplane sales. this tabl
    15·1 answer
  • Factor the expression p2-16
    10·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!