1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
gulaghasi [49]
2 years ago
12

What is the solution to the equation 3(2×+5)=3×+4×?

Mathematics
2 answers:
Misha Larkins [42]2 years ago
5 0
The answer is 15 I think
trapecia [35]2 years ago
4 0

Answer: i think it is 11x+7x

Step-by-step explanation:

You might be interested in
HELP HELP HELP PLEASE
zepelin [54]

Answer:

integer = 5

rational number but not an integer - 3 and a 1/2

irrational number - it's the one with 11

7 0
3 years ago
If f(x) =7x+5/3-x, then show that fof power -1(x) is an identity function ​
Irina-Kira [14]

If f(X)= 7x +5/3 - x =6x +5/3

y= 6x +5/3

6x= y-5/3

f^-1(y)=x=(y-5/3)/6

So we can write

f(f^-1(y))= f((y-5/3)/6) = 6 (y-5/3)/6 +5/3= y-5/3+5/3= y

The same result can be obtained for f^-1(f(x))=x

If the function is f(x)= 7x +5/(3-x) then it is not invertible since it is not injective (pictures)

4 0
3 years ago
Ashley bought 4 packages of juice boxs in each package. She. gave 2 juice boxs to each of her friends. How many juice boxes does
Harlamova29_29 [7]
I am assuming there are more than one juice box in a package so if the amount of juice boxes in each package is X and there are four packages 4X.
So 4X - 2= Answer

If we make it so that there are 6 juice boxes in each package and use the same method this is what we'll get:
24 - 2= 22

22 would be the juice boxes left over.

I hope this answers your question, if it doesn't use the same method with the number of juice boxes in a package.
8 0
3 years ago
Totsakan spent $36.54 on envelopes. If they cost 4.06/box how many boxes did her buy?
Ivahew [28]
9 because you divide 36.54 by 4.06 i’m pretty sure
4 0
3 years ago
Read 2 more answers
Given g(x)=5x+2, find g(-6)
kkurt [141]
Bcfvn. BBC bmbbc. B b vhjvchxcj church. Hvhvychbycycbffjctccycycvidycgdfrghfdhfhfhfgkepfgogigugbhvgvyvjvufbinibunobinib k hvugycvbjjvuvcubjch gju furyfucfyfjcufrdifjfcjj
7 0
2 years ago
Read 2 more answers
Other questions:
  • Ten students need to present their reports. Five can present each day. How many ways can the teacher choose a group of five stud
    12·2 answers
  • One 50-pound bag of fertilizer will cover 75 sqare feet of lawn.how many poundsof fertilizer will be needed to cover 120 sqaure
    12·1 answer
  • How many Dimes and Quarters
    6·1 answer
  • Plz help me quickly
    14·2 answers
  • 91 rounded to the nearest hundred is 100 because 91 is closer to 100 than ? on the number line
    13·2 answers
  • Write the domain and range as inequalities.
    8·1 answer
  • if alexandra increases her usual driving speed by 15 km/h, it will take her 2 hours less to make a trip to her gradnparents hous
    15·1 answer
  • Help ASAP
    7·1 answer
  • 1750 divided by 7
    8·2 answers
  • the probability tree diagram shows the probabilities that a football team will win their first two games find the probability of
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!