1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Drupady [299]
3 years ago
14

Find an explicit rule for the nth term of the sequence. -3, -15, -75, -375, ...

Mathematics
2 answers:
Helga [31]3 years ago
6 0

The answer is B, I have just confirmed it.

koban [17]3 years ago
4 0
It's a geometric progression where
a=-3\\
r=5

a_n=ar^{n-1}\\
a_n=-3\cdot5^{n-1}

You might be interested in
The square of a negative number is twenty-eight more than three times the negative number. Find the number.
MAXImum [283]
The number is x

it is negative
the square is 28 more than 3 times itself
x²=28+3x
minus (28+3x)
x²-3x-28=0
factor
(x-7)(x+4)=0
set to zero

x-7=0
x=7
this is not the answer because we were told the number was negative


x+4=0
x=-4
correct

the number is -4
test
(-4)²=28+3(-4)
16=28-12
16=16
check


the number is -4
8 0
3 years ago
Read 2 more answers
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
3 years ago
Pls give all numbers
Bess [88]
Turkey dinner has to be zero as 0/? = 0 and it would be undefined if it was ?/0

Dinner plate would be 0 as ? * 0 * ? = 0

Radish is ?^2 cake as solving for radish will get that

Cake will be 4 as turkey is 0

Since cake is 4, radish is 16

Let’s plug them in to figure it out

0 / 4 = 0 ✅
16 * 0 * 4 = 0 ✅
4 = 16 / 4 ✅
4 / 4 = 0 + 1 ✅
0 + 16 * 4 = 64

Turkey = 0
Cake = 4
Radish = 16
Dinner plate = 0
? = 64
7 0
2 years ago
10. If x = -2, y=-6 and z= 4, find the value of 4xy<br>Z​
Grace [21]

Answer:

192

Step-by-step explanation:

Given

4xyz ← substitute given values into expression

= 4 × - 2 × - 6 × 4 = - 8 × - 24 = 192

5 0
3 years ago
You put $800 in an account that earns 4% simple interest. Find the total amount in your account after each year for 3 years. (Pl
alexandr402 [8]
To get 4% of 800 you times 800 by 4 and divide it by 100. Once you have that amount you add it to 800 to find the amount you will have in your bank the first year. To get the next year's amount you then get 4% of 832(because after the first year you have more than $800) and then add the 4% to 832, that is the answer for the second year. To find the third year's amount you get 4% of the new amount (last year's total) and add it to last year's total, that is your total for the third year. So the first year will be: (800x4÷100)+800 =32+800 =832 The second year will be: 832+(832x4÷100) =832+33.28 =865.28 The third year will be: (865.28×4÷100)+865.28 =34.61(rounded off)+865.28 =899.89
3 0
3 years ago
Read 2 more answers
Other questions:
  • Polygon C CC has an area of 40 4040 square units. Kennan drew a scaled version of Polygon C CC using a scale factor of 1 2 2 1 ​
    15·1 answer
  • According to the diagram below, which similarity statements are true? Check all that apply. A. ABD ~ BCD B. ABD ~ ADC C. ABC ~ A
    12·1 answer
  • Why does the equation 35-5x+6x-36=-24-17x+17x+24 have one solution
    9·2 answers
  • Can you help me with this problem I can't find it out
    8·2 answers
  • What do I do? Help me please I'm stuck
    6·1 answer
  • Two elephants are being delivered to the zoo. One elephant weighs 23,453 pounds, and the other elephant weighs 19,916 pounds.
    6·2 answers
  • 1769.9 in hours and secs<br><br> i need help
    7·1 answer
  • In a particularly sunny month, Solaire's solar panels generated
    13·2 answers
  • Can anyone help with this?
    9·1 answer
  • A shoe store give a 25% discount on 48$ pants how much discount $
    9·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!