Answer:
Strengthen the arms.
Explanation:
If a person repeatedly lift 25 pounds of weight over the head for 1 minute and then rest for 1 minute, the outcome of this exercise is to strengthen the muscles of the arms. The lifting of weight with the help of arms, the muscles of the arms will get stronger and increase occurs in the width of the arms. This exercise done by bodybuilders to get their arms stronger as well as athlete for stronger arms and hand muscles so the outcome of lifting the weight will leads to the increase in the strength of the arms.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
He is experiencing an overdose of drugs to treat could occur
if they are taken improperly, or if decreased liver or renal function occurs.
Symptoms of overdose include severe nausea/vomiting, sweating, salivation,
hypotension, bradycardia, convulsions, and increased muscle weakness, including
respiratory muscles. This patient has diabetes and thus may have glycaemic
issues. Bradycardia and muscle weakness.
Abdominal pain and dry mouth. Tachycardia and hypertension. Emotional withdrawal and tachypnea.
One of the RNA molecules formed during the first initial stage of protein synthesis, called transcription, in eukaryotes is mRNA or messenger RNA.
