Answer:
By looking at the gene sequences. See the mutations.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Answer is B. It did not reflect the actual evolutionary relationships among organisms very well.
Explanation:
The five-kingdom system of classification was initiated or formed by Robert H. Whittaker in 1969. And it involved the Kingdoms monera, fungi, protista, animalia and plantae.
This classification system was regarded as not so good because of placement of some certain organisms. For example, in the classification system, unicellular algae were put under the kingdom protista, when other multicellular organisms like algae were being classified under the kingdom Plantae.