1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
podryga [215]
3 years ago
7

The pathophysiology of multiple sclerosis involves the demyelination and subsequent degeneration of nerve fibers in the CNS.

Health
1 answer:
Leno4ka [110]3 years ago
8 0
The answer is True :)
You might be interested in
you want to cook a healthy meal for your family. while shopping for food, you remember that it is important to read the food lab
kvv77 [185]
The date at which food/ product shouldn’t be used after the date given on the label
7 0
3 years ago
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
2 years ago
Which principle do emergency medical professionals use to reduce the pain and inflammation from an athletic injury?
earnstyle [38]

Answer:

The RICE Principle

Explanation:

Just look it up :0

7 0
3 years ago
Read 2 more answers
Which statement best describes the effect that stimulants have on your body?
Phantasy [73]
Stimulants increase heart rate, increased blood pressure, constrict blood vessels, increased blood glucose

3 0
3 years ago
Read 2 more answers
The nutrient that provides 4 calories per gram and is needed to build and repair body tissue is
Colt1911 [192]
The nutrient that provide 4 cal per gram that is needed to build and repair body tissue is Protein
3 0
3 years ago
Other questions:
  • Billy just completed an intense resistance-training workout. how long should he wait before his next weight training workout to
    11·1 answer
  • A popular talk show host, jovial and sharp-witted as usual, outlines his views on the death penalty, taking time to consider bot
    13·1 answer
  • 3) Ultrasound:
    6·1 answer
  • List any five features of adolescent friendly sex and reproductive services?
    7·1 answer
  • Which of the following is often found in individuals who are active and eating a healthy diet?
    5·1 answer
  • Which of these are not found in the caribbean?
    10·1 answer
  • A nurse is teaching a client with a vitamin B12 deficiency about appropriate food choices to increase the amount of B12 ingested
    9·1 answer
  • George is trying to decide which of two used cars to buy. He test drives each, listening to the radio while he does so. While he
    10·1 answer
  • Based on your own idea, what characteristic should a mother have?
    11·2 answers
  • Which of the following will help prevent the transmission of HALs?
    11·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!