Answer:
Rock B has a fine grainy texture and small crystals
Explanation:
1. still hasn't turned into sedimentary rock, or metamorphic. Its most likely gonna be igneous and Igneous rocks have grainy texture and small crystals since its still developing
The population would increase drastically and we would run out of resources for food. then the birth rates would eventually equal out to number of death rates . we then wouldnt have anyone alive
A large central vacuole, and chloroplasts.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
