1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Rudiy27
3 years ago
14

PLEASE HELP ASAP! THANK YOU! IF CORRECT BRAINLIEST!

Health
2 answers:
Svet_ta [14]3 years ago
4 0
C.learn to disagree without arguing
VashaNatasha [74]3 years ago
3 0
C.learn to disagree without arguing
You might be interested in
What is it called when a woman never gets there period and what should they do
IceJOKER [234]

Answer:

Absence of a woman's monthly menstrual period is called amenorrhea. Primary amenorrhea is when a girl has not yet started her monthly periods, and she: Has gone through other normal changes that occur during puberty.

3 0
3 years ago
Which part of the heart contracts and forces oxygen-rich blood throughout the body?
Dovator [93]
Left ventricle is the answer.
8 0
2 years ago
The main purpose of a leaf is:
kolezko [41]
Its to make plant food, or photosynthesis
6 0
3 years ago
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
Blood circulates through the body in two loops, with the heart at the center. Loop _____________ circulates blood throughout the
Norma-Jean [14]
It might be called two loops
6 0
3 years ago
Other questions:
  • Drag each label to the correct location on the image. Each label can be used more than once.
    9·2 answers
  • How can a friend directly influence you to buy a health product?
    13·2 answers
  • Can you please help me! thanks you:)
    7·2 answers
  • Which word best describes the role of the therapist in the humanistic approach to psychotherapy?
    7·1 answer
  • What foods do u add to your diet that are rich in protein?
    14·1 answer
  • The lungs are attached to the rib cage. <br> true<br> false
    11·1 answer
  • What is one type of aid that the red cross provides?
    10·2 answers
  • This is for PE.
    8·1 answer
  • A common at-home workout that features high-intensity cardio, strength-building exercises, and focuses on total body fitness mig
    12·1 answer
  • Along with alcoholics, a person who uses this type of drug is likely to experience amotivational syndrome?.
    5·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!