It is a transgenic organism
Answer:
Explanation:
metal can become magnetic if they have many spinning electron. When the majority of atoms spin in the same direction the strong magnetic field is produced the direction of electron spin determine the direction of magnetic field
The correct answer is option B
The proper enzymes are synthesized from the information of the gene by the process of protein synthesis. All the enzymes are protein and protein are synthesized by the process of protein synthesis. These are protein in nature so they are produced in ribosomes. The gene codes for a specific protein and produces enzymes(protein).
Answer:
The glaciers will accumulate more in amount when the planet cools, and this will result in the slow expansion of glaciers, extending horizontally and downward, due to the pressure exerted by the glaciers. The glaciers will be rapidly accumulated in the glacier head in comparison to the zone of wastage, which covers the region below the snowline. These glaciers moves at a fairly slow rate, under the influence of gravity.
As the planet cools, the terminus of the glaciers (glacier end or toe) will expand and will be distributed more outward and downward, and there will be more quantity of snow in a cool planet.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
