1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Butoxors [25]
3 years ago
8

Steven has $25 dollars. He needs to set aside $10.00 to pay for his lunch next week. If peanuts cost $0.38 per package including

tax, at most how many packages can Steve buy?
Mathematics
1 answer:
Tanzania [10]3 years ago
7 0
39 packages.

Because he sets aside 10, he has $15 left.
15 divided by $0.38 = 39.4736, however he cannot but a fraction of a package so you round down to 39.
You might be interested in
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
Solve for the MNQ angle, please add steps and how to get the answer please and thank you
dusya [7]

Answer:

x =  15

Step-by-step explanation:

3x - 13 + 58 = 90

3x - 13 = 90 - 58

3x -13 = 32

3x = 32 + 13

x = 45/3

x = 15

6 0
3 years ago
What is the volume of a cylinder with a radius of 7 cm and height of 10 cm? In terms of pi.
Rama09 [41]
Volume equals to 1539.38 cm^3
5 0
3 years ago
Is 40% of a class are girls. and 25% of girls play tennis, what is the percent of the class play tennis?
ASHA 777 [7]

Answer: a. 10%

Step-by-step explanation:

Girls in the class = 40%

Girls play tennis = 25%

Percentage of class play tennis = 40%*25% = 0.4*0.25 = 0.1

Percentage of class play tennis = 10%

5 0
3 years ago
Read 2 more answers
Evaluate (3x-y)/(3(x-y)) if x = 5 and y = 3. *
mel-nik [20]

Answer:

2

Step-by-step explanation:

Write the equation

\frac{3x-y}{3(x-y)}

Add the variables

\frac{3(5)-3}{3(5-3)}

Multiply 3 x 5

\frac{15-3}{3(5-3)}

Subtract the parentheses

\frac{15-3}{3(2)}

Subtract the numerator

\frac{12}{3(2)}

Reduce the fraction with 3

\frac{12}{3(2)} = \frac{4}{2}

Reduce the fraction again with 2

\frac{4}{2} = 2

And there's your answer of 2!

5 0
3 years ago
Other questions:
  • Six times the sum of a number and 15 is -42
    14·1 answer
  • Which of the following statements regarding immunization are true?
    15·1 answer
  • Write as a rate
    10·1 answer
  • Here are the first four terms of a number sequence.
    15·1 answer
  • Someone help <br> wh ores.
    8·1 answer
  • Diego is inviting some friends over to watch movies. He is buying popcorn and peanuts. Popcorn costs 6 cents per ounce and peanu
    14·1 answer
  • Look at the triangles shown below.
    15·2 answers
  • Johnny measured a city park and made a scale drawing. The soccer field is 6 millimeters wide in the drawing. The actual field is
    11·1 answer
  • Please help this is 10 points only but please help my little sister needs help with this
    7·1 answer
  • A parachutist's rate during a free fall reaches kilometers per hour. What is this rate in meters per second? At this rate, how m
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!