Exocytosis moves materials out of a cell.
Endocytosis moves materials into a cell.
Active transport uses carrier proteins. (not entirely sure about this one... check it out to be sure)
Molecules move from an area of high concentration to an area of low concentration by passive transport.
Answer:
DNA polymerases
Explanation:
The formation of a phosphodiester bond between adjacent nucleotides is catalyzed by the DNA polymerases. They do this efficiently only if the incoming base on the incoming nucleoside triphosphate is complementary to the base on the template strand and can bind efficiently.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer: The answer is the last option, Backflow of blood through a defective valve.
Explanation: Hypotension causes high blood pressure, and the other two options are not related to heart murmurs. A hear murmur is when the blood isn't flowing in the right direction causing the hear to beat irregularaly.
