Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
A. volcanic ash layers were regularly interspersed between the sedimentary strata.
Explanation:
The discovery of a fossil is a moment of accomplishment for archaeologists, hence the date dating process begins and the older the relic the greater its value for paleontology. Chemistry is present in this process, more precisely the carbon element, but other elements can be used as uranium, lead, potassium and argon.
In the case of the fossils reported in the question, to assign absolute dates to fossils in this sediment core would be most useful if volcanic ash layers were regularly interspersed between sedimentary strata because it would separate sedimentation times and allow the use of more than one element. dating, making the search more complete and the date most credible.
Answer:
False!
Explanation:
Moisturizers for oily skin generally contain smaller amounts of emollient.
See the file I attached for more information
Answer: The image at the top right corner of the page is the answer.
Explanation:
In the food web, arrows are pointed towards the consumer (not otherwise). In essence, two arrows should be pointed towards mouse, since it feeds on both algae and grass. While a single arrow is to be pointed to wolf, since it only feed on mouse.
Thus, the image at the top right corner of the page is the answer.
Answer:
I think it's A but I could be wrong so really sorry if I am
