1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Inga [223]
2 years ago
13

How can rights and responsibilities can affect wellbeing?

Health
1 answer:
IceJOKER [234]2 years ago
7 0

Answer:

The experience of health, happiness, and prosperity. It includes having good mental health, high life satisfaction, a sense of meaning or purpose, and ability to manage stress. More generally, well-being is just feeling well (Take this quiz to discover your level of well-being.)

Explanation:

wellbeing- that in some sense the individual's or group's condition is positive.

responsibilities- the status of morally deserving praise, blame, reward, or punishment for an act or omission performed or neglected in accordance with one's moral obligations.

You might be interested in
What is the difference between a preventative health behavior and a healthy behavior?
klio [65]

Answer: Health behavior is an action to maintain, attain, or regain good health and to prevent illness. Healthy behaviors are exercising regularly, eating a balanced diet, and obtaining necessary inoculations

Explanation:

7 0
2 years ago
When an individual stops working out, muscles slowly __________.
S_A_V [24]
Deteriorate or muscles slowly become weak would be your answer
4 0
3 years ago
Why are hematologic studies of blood important in the diagnosis of disease?
ale4655 [162]
Human blood is composed of two essential elements: the liquid consisting of water, organic matter and minerals in the solid soluble and consists of cellular elements (red cells, white cells and platelets). In case the blood harvested from the patient's vein is placed in a test tube coagulates after a few minutes. Then it is separated into a liquid layer, the upper, which is called serum and a lower layer, which is solid clot. If the tube that was harvested blood of a substance anticoagulant (which prevents clotting) when blood no longer coagulates, but separates everything into two layers: the upper layer liquid consisting of plasma and lower layer, solid, constituted coagulated celuare the elements.
From these two components serum and blood plasma will perform biochemical and serological main medical tests. Of blood cellular components is achieved hematology. Hematology investigating the number, shape, and composition characteristics of cellular elements of the blood.
4 0
2 years ago
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Tatiana [17]

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

7 0
1 year ago
What are good strategies to deal with people around you who are negative?
noname [10]
Remove them from your life. If there is no negative energy near you, there is no negativity.
7 0
3 years ago
Read 2 more answers
Other questions:
  • Swimming alone
    11·2 answers
  • True or false people of Caucasian western culture tends to have a high acceptance of western medicine relying on pharmaceuticals
    10·1 answer
  • The chart below shows our friends target heart rate zones. During their last spin class , each person averaged 170 beats per min
    15·1 answer
  • The determination as to whether or not a drug is effective or safe must be based on clinical studies and conducted by A. anyone
    15·1 answer
  • Define four selves within us
    14·2 answers
  • The heart rate that's not measured, but calculated, is called the _____.
    7·1 answer
  • Approximately how many calories are one gram of protein
    7·2 answers
  • Which of the following is not a property of enzymes?
    6·1 answer
  • Which is an acceptable way to measure radial pulse?
    6·1 answer
  • Bettina has worked hard to build healthy habits. she's very fed and maintains a healthy diet she does not think she really needs
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!