Answer:
gene flow
Explanation:
Gene flow, in simple terms, is a transfer of gene from one population to another. Also called as migration, where there is movement of individuals, and the genetic material they carry from one population to another. It also involves successful breeding of these individuals in their new locations. When people with sickle cell anemia were brought into the US, transfer of the gene responsible for sickle cell disease changed the frequency of the sickle cell allele in overall US population.
Answer:
The invention of the microscope led to the discovery of the cell by Hooke. While looking at cork, Hooke observed box-shaped structures, which he called “cells” as they reminded him of the cells, or rooms, in monasteries. This discovery led to the development of the classical cell theory.
Explanation:
hope this helped you sorry if it did not
Answer:Greenhouse gases allow thermal energy to pass through the atmosphere and back out into space
Explanation:
Answer:
Nutrients support vital functions, including growth, the immune, the central nervous system, and preventing disease.
Explanation:
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
