1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
murzikaleks [220]
3 years ago
5

Determine the standard form of the equation of the line that passes through (-2, 0) and (-8, 5).

Mathematics
1 answer:
Vladimir79 [104]3 years ago
8 0

Answer:

5x + 6y = -10

Step-by-step explanation:

(-2, 0) and (-8, 5)

m = (y₂ - y₁) /  (x₂ - x₁)

m = (5 - 0) / (-8 -(-2)

m = 5 / (-8+2)

m = -5/6

y = mx + b

(-8, 5)

5 = -5/6(-8) + b

5 = 40/6 + b

b = 5 - 40/6

b = -5/3

y = mx + b

y = -5/6x - 5/3           *6

6y = -5x -5(2)

6y = -5x - 10

5x + 6y = -10

You might be interested in
Eight less than a number, n, is at least 10.
viva [34]

Answer:

n - 8 >= 10

n minus 8 is greater than or equal to 10

4 0
2 years ago
Read 2 more answers
Sandy had an aquarium shaped like a rectangular prism that has a length of 24 inches, a width of 18 inches and a height of 26 in
AURORKA [14]

Answer:

11232 in³

Step-by-step explanation:

24*18*26

4 0
2 years ago
2 ( n - 7 ) = 20<br><br> What is n?
Sunny_sXe [5.5K]

Answer:

The answer is n = 17

Step-by-step explanation:

Divide both sides by the numeric factor on the left side, then solve.

Hoped this helped!

brainly, please?

8 0
3 years ago
This graph shows a proportional relationship.
Kamila [148]

Answer:

The constant of proportionality is 0.3, or K=0.3.

Step-by-step explanation:
The chart I attached shows points that are plotted on the proportional line. In order to find the constant of proportionality from these points, you have to divide the amount of change by the number of years. For example, 3 divided by 10 or 6 divided by 20. This results in 0.3, which means that every year, there is 0.3 centimeters of change in the sea level.

8 0
2 years ago
Write a linear equation representing a line parallel to y axis and is at a distance 3 units on the right side of y axis
arsen [322]

Answer:

hmmmm

Step-by-step explanation:

Oki y 123

x134 osiowownwhwowoeuejjensvpnevpjphpgnnqgpfnwcnpnspsvnpwnpnwpnepvnpenpqkvkvkdvke level oxbqlcnwodbwdpnqdonwpdnwfnwpnw0fj20rj10i1045882852585i205725

6 0
2 years ago
Other questions:
  • The difference between longitude and altitude
    7·1 answer
  • The mean checkout time in the express lane of a large grocery store is 2.7 minutes, and the standard deviation is 0.6 minutes. T
    15·1 answer
  • The Cute Kitten Shelter has $486$ cute kittens at the start of Monday. On each day, $\frac13$ of the kittens available at the st
    9·2 answers
  • Can someone give me answers pls asap
    6·1 answer
  • What are the solutions of the equation 9x^4 - 2x^2 - 7 = 0? Use u substitution to solve.
    14·1 answer
  • A car repair will cost $100 for parts plus $50 per hour for labor. Enter the function y that represents the total cost in dollar
    13·1 answer
  • Help please!!!! will Brainly!!!
    15·2 answers
  • 4) What is the domain of the function?<br> Please help
    5·1 answer
  • PLS HELP pls explain im confused
    14·1 answer
  • In the above figure, m AOC=26 and m BOD= (2x+39). If AOC and BOD are vertical angles whats the value if x?
    14·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!