DNA, Deoxyribonucleic acid. DNA is the empirical proof of God.
DNA can never be created naturalistically and is absolutely uniquely structured:
1. DNA contains multiple levels of coded organically constructed information that controls all cellular functions and no natural process is capable of creating or coding.
2. The amino acids that provide the coding fo the genetic information are homochiral. The few, not all, amino acids that can form naturally are not symmetric and are either left-handed or right-handed, called racemic. All amino acids in DNA, RNA, proteins, enzymes, ribosomes and other cellular assemblies are left-handed, 100%. No right-handed amino acid can function within DNA. Nature may produce a partial list of racemic amino acids, but cannot produce homochiral amino acids, again, only produced within a cell.
3. Phosphate penta-sugars provide the overall dual backplane physical structure to allow the amino acids to be affixed and are all right-handed homochiral, not produced in nature and exclusively right-handed.
B. Lowering taxes in order to stimulate spending. When the economy experiences a downturn, the government is more likely to cut taxes to allow price competitiveness of goods, thereby triggering demand, hence consumption among households. A boost in consumption should translate into an increase in supply that wwould in turn bring about job creation. The negative trend would therefore be reversed.
The remains are called fossils. Fossils are remnants of animals, plants, or microorganisms that have been solidified in the process of fossilization, where the organism is surrounded by sediment, minerals, and other solid objects which are compressed and heated around the organism over time. This forms a solid mass with the preserved organism inside, other known as a fossil.
Fitness. Give me brainliest please
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
