It is scientifically known as Hidrologic Cycle
Just think about cancer.. it's uncontrolled cell growth, so mutations in genes can cause cancer by accelerating cell division. As the cells contribute to grow they then develop as a tumor.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Photosynthesis uses sunlight energy to make glucose (energy stores). A by-product of photosynthesis is oxygen. plants use water and sunlight to grow and they produce oxygen. Animals eat plants, use oxygen and breathe out carbon dioxide. Since the space station is in the shadow of the earth, the plants are unable to complete the process of photosynthesis and the carbon dioxide that is being produced by the humans cannot be utilized by the plants due to no sunlight. Therefore the carbon dioxide is going to continue to build up as the energy storage molecules are being depleted and not replenished.
Answer:
We reduce the size of the cell
and increase surface area to volume ratio.
Explanation:
