Ask question

Ask question

All categories

Dahasolnce [82]

3 years ago

13

IQ scores for adults aged 20 to 34 years are normally distributed according to N (110,25). Use the empirical rule to answer the

following: Approximately what percent of people in this group have scores below 110?

1 answer:

xxTIMURxx [149]3 years ago

6 0

Since the mean of the distribution is 110, and the distribution is normal, then 50% of the the people will have scores below 110.

You might be interested in

You are about to toss

Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0

3 years ago

PLEASE HELP ME QUICK!!

9966 [12]

Answer: yes kevin skied as long as lori

3 0

2 years ago

In how many different ways can you make exactly 0.75 using only nickles dimes and quarters if you have at least one of each coin

harina [27]

18 different ways to make $75

4 0

3 years ago

(Worth 30 points) What are the explicit equation and domain for an arithmetic sequence with a first term of 5 and a second term

kolbaska11 [484]

Answer:

$a_n=5-2(n-1)$ , all integers where n≥1

Step-by-step explanation:

we know that

The explicit equation for an arithmetic sequence is equal to

$a_n=a_1+d(n-1)$

a_n is the th term

a_1 is the first term

d is the common difference

n is the number of terms

we have

$a_1=5\\a_2=3$

Remember that

In an Arithmetic Sequence the difference between one term and the next is a constant, and this constant is called the common difference.

To find out the common difference subtract the first term from the second term

$d=a_2-a_1=3-5=-2$

substitute the given values in the formula

$a_n=5-2(n-1)$

The domain is all integers for $n\geq 1$

3 0

3 years ago

Please help me!!!<br> Show work!!!<br> ____ % of 60 is 30

sergey [27]

Answer:

50%

Step-by-step explanation:

50% is equal to 1/2.

1/2 of 60 is 30.

5 0

3 years ago

Read 2 more answers