Answer:
Yes they do.
Explanation:
Both plant and animal cells contain ribosomes. Some may be found floating in the cytoplasm while others may be found in the rough Endoplasmic Reticulum.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
B
Explanation:
This involves selectively breeding two or more populations of a species or subspecies with desirable traits that are wanted by the humans. The offspring of the populations will bear the desired traits from the population. Breeding can be done over generations. An example is the breeding a cattle population that is resistant to drought and another that produces more milk. The filial generations will bear both traits.
The answer would be Cement,Bricks, and rock salt because in Florida they mine for hard materials
Answer;
Heterozygote advantage occurs when heterozygotes have a higher fitness than do both homozygotes. In frequency-dependant selection, the fitness of a phenotype declines it it becomes too common in the population.
Explanation;
The heterozygotes have both alleles, which is needed for genetic variation. Heterozygotes are essential for there to be genetic variation in a population. In other words it is when When a single copy of a disease allele doesn't result in a disease but instead is good for the person or organism that carries it, we say that allele has a heterozygote advantage. For example a sickle cell trait, which protects against malaria in heterozygotes, but causes a deadly disease in homozygotes.
-Frequency-dependent selection occurs when the fitness of a genotype depends on its frequency. It is possible for the fitness of a genotype to increase (positively frequency-dependent) or decrease (negatively frequency-dependent) as the genotype frequency in the population increases.
