<span> Basically the male will have CC, the hen will have cc, and neither of them will have I. The key thing is that _all_ the chicks are coloured.
The male must have at least 1 C to be coloured, and cannot possess the dominant I. The hen has cc and/or an I to not be coloured.
That one chick is coloured would tell you little - only that the hen couldn't have 2 inhibitor alleles because otherwise the chick would have to have one and it doesn't.
However, for all of many chicks to be coloured, that means that the hen can't have any inhibitor alleles (otherwise around 50% would be white for that reason alone).
So to be colourless, the hen must be cc. However, if the male had only 1 colour allele (ie it was Cc) that would still mean that 50% of the chicks would be Cc (daddy's 'c' and one of mummy's 'c's).
Hope this helps please award brainly :)
</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The answer is <span>gametes:</span>
Answer:
the complementary nucleotide to adenine.
Explanation:
mRNA is formed as a complementary strand to one of the two strands of the DNA. Three of the four nitrogenous bases that make up RNA — adenine (A), cytosine (C), and guanine (G) — are also found in DNA. In RNA, however, a base called uracil (U) replaces thymine (T) as
