Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
The correct options are as follows"
1.B.
Postzygotic isolation is a type of reproductive isolation which keeps species from mating with each other as a result of the differences that developed between them when they are separated by physical boundary. In the question given above, the lizard specie has been separated by the formation of a stream which divide the region into two.
2.B.
Allopatric speciation refers to the mode of speciation that occur when biological population of the same specie become isolated from each other to an extent that it interferes with genetic interchange. It usually occur as a result of change in the environment.
<span>Chlorophyll green pigment is responsible for the color of the epidermal cells of the zebrina. This is because the zebrina is a plant and plants, particularly the leaves are green from chlorophyll. Chlorophyll is found in cyanobacteria and the cytoplast.</span>
There are four organelles that are involved in protein synthesis. Those are the following: Nucleus ribosomes, the rough endoplasmic reticulum and the Golgi apparatus, or the golgi complex. All four work together to synthesize, package and process proteins. Protein synthesis begins with DNA.
Answer:
Hope this is helpful to you!
The Agricultural Revolution of the 18th century paved the way for the Industrial Revolution in Britain. New farming techniques and improved livestock breeding led to amplified food production. This allowed a spike in population and increased health. The new farming techniques also led to an enclosure movement.
