Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>crushing a can.
melting an ice cube.
boiling water.
mixing sand and water.
breaking a glass.dissolving sugar and water
.shredding paper.
<span>chopping wood.</span></span>
Vegetative reproduction, also known as vegetative propagation, is the process in which a single parent plant has an offspring that is identical to the parent, genetically. The offspring grows from parts of the parent plant. So, the answer to this questions is a.
I think the answer is :extinct
Answer: The answer is D. Hope this helps :)
Explanation:
