1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Andrej [43]
2 years ago
6

Which describing words would be good for a roman emperor

History
1 answer:
Fofino [41]2 years ago
4 0
Republic

old

intense

multicultural

practical

roman

isolated

vast

exhausting

rich
You might be interested in
How far away is the sun from pluto
maksim [4K]

3.67 billion miles is the distance

7 0
3 years ago
Read 2 more answers
Labor unions were formed in the late 1880s, after they were formed, factory life changed dramatically.
NNADVOKAT [17]

Part A: Working hours changed from around 14 hours a day before the 1880's to being reduced slowly down to 12, then 10, eventually moving to an 8 hour day. This change allowed for workers to to have more time to sleep and for leisure. Another change was the end of child labor. Similar to the decrease in hours, the minimum age increased over time as well moving from 10 to 16.

Part B: One strategy used by unions to achieve these goals were strikes. Workers would leave the job and picket outside of a job which shut down operations. This tactic did not work at first because there were plenty of workers to fill the jobs. However, when immigration slowed the tactic had more impact with no people to fill the jobs. Some strikes were so large they brought the attention of police forces and the government.

8 0
3 years ago
Look back at the paragraph you wrote for Activity 14. Now that you have finished reading the novel, add another paragraph that s
Vedmedyk [2.9K]
Ooiiuuytrrrwwassssssdddfffffffggggghhhhhhkkkllllmmnnbbvvcccz
5 0
2 years ago
What was the basic aim in a direct democracy
Ksivusya [100]
The answer is majority rule
6 0
2 years ago
Read 2 more answers
Please help ASAP!
Verizon [17]
B) Many believed that the refugees would increase economic problems and cause conflict with Germany. 
3 0
3 years ago
Read 2 more answers
Other questions:
  • What happened on 9/11
    15·2 answers
  • Why did Hitler feel justified in taking over Austria and the Sudetenland?
    13·2 answers
  • Place the events in chronological order. Start by clicking the first item in the sequence or dragging it here Drag the items bel
    7·1 answer
  • Explain the importance of the Sumerian writing system
    9·2 answers
  • What is the name of the person who said, “give me liberty, or give me death”?
    5·2 answers
  • 30. What is seen as the route to the final frontier?
    5·1 answer
  • What were the goals behind the creation of the League of Nations? Check all that apply.
    12·2 answers
  • What is the purpose of an exit poll?
    11·1 answer
  • ¿Qué diferencia existe y cómo se relacionan: macrosistemas, sistemas y subsistemas?
    6·1 answer
  • What system emerged (began) in the late 1860's? plantationism or sharecropping
    6·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!