Answer:
C) 30,000
Explanation:
According to the given information, the bacterial mRNA consists of about 800 nucleotides. Three consecutive nucleotides together make one genetic codon which in turn codes for one specific amino acid in the protein encoded by this mRNA.
So, an mRNA with 800 nucleotides will have total 800/3 = 266.67 or 266 genetic codes. The protein encoded by this mRNA would have a total of 266 amino acids.
Given that one amino acid imparts 110 units to the molecular weight of the protein, the protein with 266 amino acids have the molecular weight= 266 x 110 = 29260, that is about 30,000.
Polypeptide chains undergo some modifications before they become fully functional. Some of these modifications include: proteolytic cleavage, lipidation and glycosylation. Proteolytic cleavage refers to the removal of some amino acids from a polypeptide chain by proteases in order for the protein to become active. An example of a substance that is modified through this process is insulin.
What it is , you do when you eat
Im not even sure
goodluck tho !,
^-^
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Force and displacement must be present according to formula and if asking about components then maybe X and Y
