B. because it is dependent on something to manipulate (change) it, that is why it is called a dependent variable :)
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
According to the Cornwall Alliance, Earth is which of the following? The resilient creation of God’s wise design
Explanation:
Answer: a. dead organisms from the marine food web.
c. liberation through ATP hydrolysis in living organisms.
Upwelling is a wind driven motion of lower bottom nutrient rich and warmer water on the surface of the water body. This wind driven motion facilitates the movement of nutrients available for growth of primary producers like phytoplanktons growing on the surface of water body. The dead organisms from the marine food web get decomposed and the organic matter obtain after decomposition is a rich source of phosphorous. This phosphorous gets transferred to the upper layers of the water body by upwelling. In aquatic organisms ATP hydrolysis occurs which is a catabolic process that uses water to split the bonds present in the ATP molecule and hence, releases energy for functions performed by them along with a release in phosphate atom. This phosphate gets mixed with the water. Therefore, PO32 come from dead organisms from the marine food web and liberation through ATP hydrolysis in living organisms that circulates due to upwelling.
