What are decomposers

1 answer:

6 0

Decomposers are bacteria that break down decomposing or rotting dead organisms, or something that was alive one (weather it be human or just nature) and slowly dies away with the help of decomposers. hope this helps.

You might be interested in

Help will give brainiest thanks and points <br> please and thank you

goldenfox [79]

Answer:

all of the above

Explanation:

6 0

3 years ago

Read 2 more answers

A protein contains an ER signal sequence at amino acid positions 7 to 15. At amino acids 25 to 40 the protein also contains a mi

Digiron [165]

Answer:

Explanation:

ER signal sequence: The sequence ([n]MLSLRQSIRFFKPATRTLCSSRYLL) is located at the N-terminus and begins with one or more charged amino acids followed by a stretch of 6 to 12 hydrophobic residues. Mitochondrial signal sequence: The sequence ([n]MVAMAMASLQSSMSSLSLSSNSFLGQPLSPITLSPFLQG) is 3 to 70 amino acid long alternating hydrophobic and positively charged amino acids.
ER and mitochondria. The ER and mitochondria are known to interact; so the peptide may be translocated from the ER to the mitochondria. The ER retention signal (KDEL), if present it targets the protein to the ER lumen.
Yes. It can be trafficked to the mitochondria if it does not have the ER retention signal.

4 0

3 years ago

In which stage of the cell cycle does a cell contain twice its normal number of chromosomes?

-Dominant- [34]

Answer:

anaphase

Explanation:

(don't mind this need 20)

8 0

3 years ago

2. Which is not a reason to abstain from alcohol?

nadezda [96]

D for sure. That seems perfectly christian-minecraft server-y of a school to put that as an option, it must be right.

6 0

3 years ago

Read 2 more answers

Identify the different types of RNA and sections of RNA.

lana [24]

Answer:

Carries copies of the instructions for assembling proteins: messenger RNA

Makes up the subunits of ribosomes: ribosomal RNA

Carries amino acids and matches them to the coded message for assembling proteins: transfer RNA

sections of an mRNA molecule that are removed: introns

Sections of an mRNA molecule that are not removed, and are joined together to form the completed molecule: exons

4 0

3 years ago