1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
iren [92.7K]
3 years ago
8

Find the distance between u and v in the coordinate plane​

Mathematics
1 answer:
nexus9112 [7]3 years ago
8 0
Hi! Your answer is D explain below!

You might be interested in
Factor the polynomial by factoring out the GCF. <br> 20a^2 + 4a
jekas [21]

Answer:

4a(5a + 1)

Step-by-step explanation:

Given

20a² + 4a ← factor out 4a from each term

= 4a(5a + 1)

5 0
3 years ago
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
Pleaseee help I will give you all my points
suter [353]

Answer:

Ruben??

Step-by-step explanation:

Just a guess, If another person answers Listen to them

4 0
3 years ago
An instrument is NOT defective when: A holder is on notice that an instrument is defective when the holder: Julian receives a pr
saw5 [17]

Answer:

no

Step-by-step explanation:

3 0
4 years ago
What is a factor of 21x² + 13x - 20
Tems11 [23]

Answer:

(7x-5)(3x+4)

Step-by-step explanation:

4 0
3 years ago
Other questions:
  • What are the two consecutive integers and 56
    7·1 answer
  • One year, Super Bowl commercial time sold for $4.5 million for 30 seconds of air time.
    13·1 answer
  • What happens to a quotient when the divisor increases?
    15·1 answer
  • Help! I don't know how to do this, you could explain or help pls pls pls<br><br>(2x2+7x−4)+(−10x−4)​
    15·1 answer
  • What is the answer to 2.4 × 10-4
    13·2 answers
  • Y = x2<br> -2<br> What is the Domain:
    13·1 answer
  • Solve.<br> 10-80+300+900-1000+1000-2+10000000-1x0
    8·2 answers
  • Help I please I will give crown if correct 10points!!!<br><br> Don’t skipppp pleaseee
    5·1 answer
  • Work out the size of angle x.
    9·2 answers
  • A server makes $200 a week working at a local restaurant. The server saves 35% of the $200 weekly earnings each week for 4 weeks
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!