1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
nlexa [21]
3 years ago
13

1. In Kite ABCD below, point E is the midpoint of segment BD. What are the

Mathematics
1 answer:
Anvisha [2.4K]3 years ago
6 0

Answer:

The coordinates of point D( 4,4)

Step-by-step explanation:

<u><em>Step(i):-</em></u>

Given points are E(10,4) and B(16,4)

'E' is the mid-point of segment BD

Let D(x₁, y₁) be a point

   E = midpoint of segment BD

 (10,4) = (\frac{x_{1} +x_{2} }{2} , \frac{y_{1} +y_{2} }{2} )

10 = \frac{x_{1} +16 }{2}    

20 = x₁ + 16

20-16 = x₁

  x₁ =4

<u><em>Step(ii):-</em></u>  

\frac{y_{1} +y_{2} }{2}  =  4

\frac{4 +y_{2} }{2}  =  4

4 + y₂ = 8

    y₂ = 8-4 =4

The co-ordinates of point D( 4,4)

You might be interested in
Which best describes the range of the function f(x) = 2/3(6)x after it has been reflected over the x-axis?
liq [111]
Your post (" <span>f(x) = 2/3(6)x ") would be clearer and less ambiguous if you'd please format it as follows:

</span><span>f(x) = (2/3)(6)^x.  The (2/3) shows that 2/3 is the coefficient of the exponential function 6^x.  Please use " ^ " to indicate exponentiation.

Start by graphing   </span><span>f(x) = (2/3)(6)^x.  The y-intercept, obtained by setting x=0, is (0, 2/3).  Can you show that the value of f(x) is (2/3)*6, or 4, at x=1, (2/3)*6^2, or 24, at x = 2, and so on?  What happens if x becomes increasingly smaller?  The graph approaches, but does not touch, the x-axis.

If you complete this graphing assignment, then all you'd have to do is to flip the whole graph over vertically, reflecting it in the x-axis.  You'll see that the graph never touchs the x-axis.  Therefore, the range of this flipped graph is (-infinity, 0).</span>
7 0
3 years ago
Read 2 more answers
Please answer this correctly
vovangra [49]

Answer:

Cable: 10%  Satellite: 40%  Streaming Service: 50%

Step-by-step explanation:

There are 10 friends  

1 has cable

4 have satellite

5 have streaming service  

Which means:

Cable is 10%

Satellite is 40%

Streaming Service is 50%

5 0
3 years ago
Read 2 more answers
You are about to toss
Reil [10]

Answer:

sffewetgryhntrfvrfvfewragtehyrnmhnsgbfvdsfsegrtew

3 0
3 years ago
Find the rate of change in the table​
mixas84 [53]

Answer:

I'm pretty sure it's +(-6).

Step-by-step explanation:

Basically for these, you find the slope. The slope equation is y1-y2/x1-x2.

Pick two points.

I'll just do (1,15) and (2,9).

15-9/1-2 = 6/-1 = -6.

I don't know if you were taught it this way, but my math teacher always told us that the rate of change had to be positive.

So you'd say the rate of change is +(-6), not -6.

Hope that sorta helped lol

3 0
3 years ago
Real numbers worksheet<br> Help please and ty
Rina8888 [55]

Answer:

1. 30 → real, rational, integer, whole number, natural number

2. •11 → real, irrational

3. 5 ⁴/7 → real, rational, integer

4. √21 → real, irrational

5. 0 → real, rational, integer, whole, natural

6. -√9 → real, rational, integer, whole

7. 6/3 → real, rational, integer, whole, natural

8. π → real, irrational

9. 5⅔ → real, rational, integer

Step-by-step explanation:

.

7 0
3 years ago
Other questions:
  • What kind of sequence is this? 143, 125, 107, 89, ...
    9·1 answer
  • I think n but im not sure can someone help?
    13·1 answer
  • Is The number “-3” a integer?
    8·2 answers
  • What do roller coasters, astronaut training, and a curved shape of a dam all have in common?
    13·2 answers
  • What is the GCF of these 2 numbers : 120 and 60
    7·2 answers
  • Which statement best describes the relationship between forces? (2 points)
    14·1 answer
  • Please help, thank you.<br><br> The question is in the picture
    9·2 answers
  • What is the answer for this question ??
    8·2 answers
  • Identify the property of equality that makes Equation 1 and Equation 2 equivalent.
    9·1 answer
  • Which number is composed of exactly 8
    12·2 answers
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!