The distant galaxies we have seen are moving away from earth by the red shift the law that describes its expansion is Hubble's law. It is regarded as the main observational basis on enlargement of the world. and imitation to acquire the supportive evidence over big bang model. It states that galaxies are becoming extinct at a speed that is proportional to their distance.
Answer:
Sickle sale is a disease in an offspring which is caused by abnormal type of red blood cell Jean inheritance from the parents what is the name for different forms of the same gene?
Mutation HBB gene
Explanation:
Answer:
Nutrient-rich blood flows into the liver from the intestines through the hepatic portal vein.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
