1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
LenaWriter [7]
3 years ago
14

The driving force presented by Wegener for his hypothesis was that continents ploughed through ocean crust.

Biology
1 answer:
babymother [125]3 years ago
3 0

Answer:

"Alfred Wegener suggested that continental drift occurred as continents cut through the ocean floor, in the same way as this icebreaker plows through sea ice. ... The supercontinent later broke apart and the continents having been moving into their current positions ever since. He called his hypothesis continental drift."

You might be interested in
Hubble's law states that galaxies are receding from us at a speed that is proportional to their ________. distance orientation v
alukav5142 [94]
The distant galaxies we have seen are moving away from earth by the red shift the law that describes its expansion is Hubble's law. It is regarded as the main observational basis on enlargement of the world. and imitation to acquire the supportive evidence over big bang model. It states that galaxies are becoming extinct at a speed that is proportional to their distance. 
3 0
3 years ago
Use the diagram below to identify letter A.
Fiesta28 [93]

Explanation:

the last one oesophagus.

hope this helps you.

7 0
3 years ago
Read 2 more answers
Sickle sale is a disease in an offspring which is caused by abnormal type of red blood cell Jean inheritance from the parents wh
Zanzabum

Answer:

Sickle sale is a disease in an offspring which is caused by abnormal type of red blood cell Jean inheritance from the parents what is the name for different forms of the same gene?

Mutation HBB gene

Explanation:

4 0
3 years ago
Nutrient rich blood from the instestines flows directly to
LenaWriter [7]

Answer:

Nutrient-rich blood flows into the liver from the intestines through the hepatic portal vein.

7 0
3 years ago
Read 2 more answers
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
Other questions:
  • Which of the following activities is
    13·2 answers
  • Like chordates, all invertebrates have
    5·1 answer
  • What habitat is home to 50% of animal species, 70% of plant species, and is currently being destroyed by humans?
    6·1 answer
  • A student has to perform an experiment on the effect of heat on a particular chemical which can be seen in the form of a color c
    6·2 answers
  • Why did mendel study pea plants ?
    11·2 answers
  • Need somebody to help!!!!
    10·2 answers
  • How does the switch work?
    8·2 answers
  • What causes Swollen Shoot Disease?
    13·1 answer
  • Which of the following are true regarding ores?
    12·1 answer
  • Which stage of the cell cycle involves the division of the cytoplasm?
    8·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!