Answer:
C and E
Explanation:
A wavelength, when drawn like this, is between two points in the exact same spot of the wave, but in different positions. Here, C is the middle when the wave is going "down" into the trough. The next point at this position is point E, giving us our answer.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
yes
Explanation:
yes because they are only made of one cell
Answer:
16 genetically different offspring
Explanation:
This is the case as each parent has the ability to produce 4 uniquely different gametes through independent assortment. With such a scenario where each parent can product 4 uniquely different gametes multiplied by 4 parents, you have 16 offspring. So there's the possibility of producing 16 offspring that are unique.
Answer:
An ecologist must consider both of the speciation and extinction of an organism or when analyzing the diversity the life on earth because of the following reasons;
- It is a role of an ecologist
- It is part of their job
- This will tell the existence of the organism
- The organism’s life span on earth
- How it was existed and were extinct
Explanation:
