A zoologist analyzes the jawbones of an extinct mammal and concludes that it was an herbivore. The zoologist most likely came to this conclusion based on the shape of the teeth.
Animals that consume plants, such as deer, elephants, cows, and many others, are known as herbivores. They eat a range of vegetables, fruits, grasses, grains, and other foods depending on the habitat of the specific animal, hence they are essentially vegetarians.
The broad, flat teeth of herbivores are perfect for chopping up the plant material they consume. These animals' teeth enable them to break down the fibers in their food, making it much simpler for them to digest.
Plant-eating animals known as herbivores have large, flat molars and sharp incisors. They don't own any dogs. The incisors, canines, and molars of omnivores are used for a range of foods. The teeth of herbivores are designed to crush and ground vegetation.
To learn more about herbivores refer to:
brainly.com/question/14480770
#SPJ4
A. <span>A flatworm doesn't have a coelom
Flatworms and other invertebrates belong to a specific group called </span><span>acoelomate, wherein they lack a coelom and has an internal cavity which serves as their digestive cavity.</span>
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
White blood cells.
Explanation:
The first line of defence (or outside defence system) includes physical and chemical barriers that are always ready and prepared to defend the body from infection. These include your skin, tears, mucus, cilia, stomach acid, urine flow, 'friendly' bacteria and white blood cells called neutrophils.
The stem cell will go through mitosis to cause the differentiated cells it produces to also be cancerous; option A
<h3>What is mitosis?</h3>
Mitosis is a process in cells which accounts for the production of new cells by the division of cells.
Cancer results when there is abnormal growth and division of cells.
Therefore, mitosis occurs or stem cells to become cancerous.
Learn more about mitosis at: brainly.com/question/19058180
#SPJ1