Answer:
There are two main types of adaptation: physical and behavioral. Physical adaptations are special body parts that help a plant or animal survive in an environment.
Explanation:
A federal government is the type of government that combines aspects of both unitary and confederal government. The United States has a federal government.
All except number 2. Hope this helps!
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Prophage occurs when it detaches from carbohydrates to create a virus. The correct option among all the options that are given in the question is the third option or the penultimate option or option "C". I hope that this is the answer that has actually come to your desired help.
