1answer.
Ask question
Login Signup
Ask question
All categories
  • English
  • Mathematics
  • Social Studies
  • Business
  • History
  • Health
  • Geography
  • Biology
  • Physics
  • Chemistry
  • Computers and Technology
  • Arts
  • World Languages
  • Spanish
  • French
  • German
  • Advanced Placement (AP)
  • SAT
  • Medicine
  • Law
  • Engineering
Masteriza [31]
3 years ago
11

Which group of organisms can be considered a population

Biology
2 answers:
inna [77]3 years ago
5 0

Answer: Is a group of organisms of the same species that interbreed for example a group of robins in North America

Sati [7]3 years ago
4 0
Answer: population is defined as a group of organisms of the same species that live in a particular area. There can be more than one population living within any given area. There can be a population of Saguaro Cacti, a population of Cactus Wrens and a population of Bark Scorpion living in the same areas.

Hope this helps (:
You might be interested in
Compare and Contrast a nucleotide with a monosaccharide.
Artist 52 [7]

Answer: nucleotides and monosaccharides are both monomers of macromolecules (nucleic acids and carbohydrates)

Explanation:

6 0
3 years ago
What are the main Differences between prokaryotic and eukaryotic cell.
Gre4nikov [31]

Answer:

prokaryotes have no nucleus and membrane bound organelles but eukaryotes do

6 0
3 years ago
Read 2 more answers
2- Explain how land that gets broken up can<br> contribute to loss of species diversity
Minchanka [31]

Explanation:

Broken up land land contributes to a loss of species diversity through geographoc isolation. Geographic isolation is the physical barrier dividing the communities. It usually stops the gene flow between species in a process called allopatric speciation, contributing to reproductive isolation.

Further Explanation:

Spontaneous modifications in the genome can occur during the cycle of cell division, called mutations. These errors occur as copies of the DNA are produced within the cell; mutations may range from small modifications called single nucleotide polymorphisms to large-scale deletions and multi-gene additions.

Such mutations create variations that within a group become dominant, resulting in the creation of different, genetically distinct organisms called species.

Learn more about mutations at brainly.com/question/4602376

Learn more about DNA and RNA at brainly.com/question/2416343?source=aid8411316

#LearnWithBrainly  

7 0
3 years ago
4a) From the sequence below, identify which portion could be a transmembrane helix. Please underline the portion you select in y
arlik [135]

Answer:

FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT

The bold region of the above sequence will be in the transmembrane region.

4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.

4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.

7 0
3 years ago
reverse transcriptase is an enzyme found in association with retroviral activity. it has the property of ________.
Veronika [31]

Answer: synthesis of DNA from an RNA template

6 0
2 years ago
Other questions:
  • 6. What is a controlled experiment? *
    15·1 answer
  • The complementary base pairs in a dna molecule are stabilized by
    5·1 answer
  • Primero: mencionar cómo la ciencia nos permite conocer los diferentes mecanismos que emplean los vegetales y animales en el proc
    15·1 answer
  • What is the general term for any carbohydrate monomers
    12·2 answers
  • The retina of the eye bends light rays and focuses them. True or False?
    9·2 answers
  • Help meeeeeeee SCREEEEEEEE I think its c
    12·2 answers
  • The five most prominent pools where carbon is stored include the Earth's crust, oceans, soil, atmosphere, and the ________.​
    15·2 answers
  • Write a response to this in paragraph form:
    5·1 answer
  • What are the membrane structures that function in active transport?
    15·2 answers
  • ____ is a blanket of fat wrapped around the main part of the neuron that keeps the brain's electrical signals on one path and in
    7·1 answer
Add answer
Login
Not registered? Fast signup
Signup
Login Signup
Ask question!