Answer: nucleotides and monosaccharides are both monomers of macromolecules (nucleic acids and carbohydrates)
Explanation:
 
        
             
        
        
        
Answer:
prokaryotes have no nucleus and membrane bound organelles but eukaryotes do
 
        
                    
             
        
        
        
Explanation:
Broken up land land contributes to a loss of species diversity through geographoc isolation. Geographic isolation is the physical barrier dividing the communities. It usually stops the gene flow between species in a process called allopatric speciation, contributing to reproductive isolation.
Further Explanation:
Spontaneous modifications in the genome can occur during the cycle of cell division, called mutations. These errors occur as copies of the DNA are produced within the cell; mutations may range from small modifications called single nucleotide polymorphisms to large-scale deletions and multi-gene additions.
Such mutations create variations that within a group become dominant, resulting in the creation of different, genetically distinct organisms called species.
Learn more about mutations at brainly.com/question/4602376
Learn more about DNA and RNA at brainly.com/question/2416343?source=aid8411316
#LearnWithBrainly  
 
        
             
        
        
        
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
 
        
             
        
        
        
Answer: synthesis of DNA from an RNA template