Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
Answer:
Energy transferred during a chemical reaction. ... In an exothermic reaction, the potential energy of the system goes down, and heat is given out. In an endothermic reaction, the potential energy of the system goes up, and heat is taken in.
Explanation:
Answer:
A is pointing to the cell membrane. The cell membrane's main function is to provide protection for the cell as well as allow substances in and out of the cell due to selective permeability.
Explanation:
Some other functions:
-Endocytosis and Exocytosis
-Cell Signaling
Answer:
I am pretty sure that the answer is A.
Explanation:
Protein kinases regulate the cell cycle by giving the "go-ahead" or "stop" signal at checkpoints in the cycle. A mutation/disruption in the protein kinases can result in it not doing its job properly. As a result, it can give the 'go-ahead' signal to all cells (mutated or not) to continue through the cell cycle. A distrupted kinase will infleunce the enviornment for a cancer cell as the cancer cell can continue to divide continuously.
I do not think the answer is D because G-couped receptirs are not involed in the regulation of the cell cycle. Additionally, I do not think the answer is C since the production of cAMP (a secondary messgenger amplifies transduction signals; this doesn't have anything to do with cancer?) Finally, between A and B I know that a direct result of cancer is due to a distruption in either protien kinases or growth factors (not in the answer choices). Since one of the factors that leads to cancer is present in answer choice A, I think that is the one. However, this is just my reasoning, I am not 100% sure!
