2 because animals do not have chloroplast or a cell wall
Answer:
fjfjdizisjsnerbrhdhsisicucizisjsjw
Answer:
Answer is A. B-hemoglobin mRNA is translated more efficiently than is a-hemoglobin mRNA.
Explanation:
The introduction of electric charge into a gel or fluid, causing or resulting in the movement of the charged particles in the gel or fluid, is referred to as the electrophoresis. It can also be explained as a separation method or technique which is based on the movement of particles or ions in an electric field.
The electrophoresis is used in separating DNA fragments , RNA or protein, based on their size and charge.
Deductive reasoning.
Deductive reasoning is a type of reasoning where a general fact is broken down into a more specific case to make an inference. This general fact can be a broad branch of knowledge then gets into its parts that may comprise this broad knowledge.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
