Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<span>the pelvic colon, rectum, and bladder
</span>
<span>Sugar is carbohydrates, fats are lipids, amino acids are proteins, and nucleotides are nucleic acid. They're all about the same healthiness because everyone needs all four for their diet. Carbohydrates give us energy, lipids provide energy, protein builds our structure, and nucleic acid stores our genetic information.</span>
The nurse should tell the patient that she will help her to get warm blankets in order for the chill to go away. Feeling of chills after giving birth is a common experience and it happens as a result of vasomotor reactions that occur during birth. Covering the patient with blanket will remove this discomfort.
