The supplementary fact panel is used for the dietary supplements. This supplement fact panel on the dietary supplements is similar to the nutritional fact panel, which is present on most of the packaged products. The supplementary fact panel denotes the information about the beverage and the benefits of the product are listed under it too.
Hence, the answer is 'nutritional facts on foods'.
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
A cell is the smallest LIVING unit in a body. An atom is the smallest "nonliving" unit.
Urinary obstruction, Neurogenic bladder, Catheterization, Pregnancy and diabetes
