The mRNA base arrangement shaped amid the translation utilizing the DNA grouping appeared above label feline ggc at is TAG CAT and GGC would combine with UTC GTU and TTG.
The single mRNA atom is blended as a constant strand. The other contrast between the two procedures is that amid DNA union the whole chromosome is replicated. Amid translation, particular qualities are deciphered in light of signs, for example, interpretation elements.
There is not any options but the parts of Lac Operon is:
Promoter
Repressor
Operator
Genes
Hope this helps!
bt bb bz bz bs bs db h bj bg
Explanation:
hajans
Answer:
FRYVNGPVLIRKLYSWWNLIMILLQYFAIMGNLVMNLVMNTGDVNELTANTITT
The bold region of the above sequence will be in the transmembrane region.
4.b) To predict the helix we need to know the propensity of each amino acid in the amino acid sequence to form an alpha helix of the protein. Not only the propensity of a single amino acid will dictate that but also other amino acids in its vicinity will have an effect on it. More importantly, that should follow the Ramachandran plot.
4.c) I chosen that region based on the hydropathy index of the stretch of amino acids. The region of amino acids should have hydrophobic side chain because they will interact with the hydrophobic tail of the lipids in the cell membrane. So this region has higher hydropathy index than others. This lead me to choose that region.
<h2>Active and Passive Immunity</h2>
Explanation:
- Immunity can be obtained distinctly and Recovery from clinical tetanus doesn't bring about assurance against future disease by <em>active or passive immunization</em> and recovery from the clinical<em> for example, immunization, immunoglobulin treatment, or move of maternal antibodies through the placenta</em>
- Active inoculation stimulates the <em>immune system to deliver antibodies against a specific irresistible specialist</em>
- <em>Active immunity</em> can emerge normally, as when somebody is presented to a pathogen.<em> For example,</em> a person who recuperates from a first instance of the measles is <em>insusceptible to advance immunity</em>
